{"product_id":"proteintech-84761-2-rr","title":"Proteintech, 84761-2-RR, SPTAN1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SPTAN1 (84761-2-RR) by Proteintech is a Recombinant antibody targeting SPTAN1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n84761-2-RR targets SPTAN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 3T3-L1 cells, HeLa cells,  mouse brain tissue,  Jurkat cells,  MDA-MB-231 cells,  rat brain tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPTAN1 (Nonerythroid spectrin αII), also termed α-Fodrin, is a cytoskeletal protein that belongs to the family of spectrins. Spectrins includes several structural proteins (α- and β-spectrin, α-actinin, dystrophin, and utrophin) that build and stabilize the cytoskeleton by forming a hexagonal mesh under the plasma membrane and ensuring stability and organization of organelles in the cell. SPTAN1 encodes for a 2,472 amino acid protein with a predicted molecular weight of 284 kDa and can be cleaved by calpain leading to a 150 kDa fragment (PMID: 31186638).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag36472 Product name: Recombinant human SPTAN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2315-2472 aa of NM_003127.3 Sequence: RNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN Predict reactive species\nFull Name: spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)\nCalculated Molecular Weight: 285kDa，2472aa\nObserved Molecular Weight: 285 kDa,150 kDa\nGenBank Accession Number: NM_003127.3\nGene Symbol: SPTAN1\nGene ID (NCBI): 6709\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13813\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888826732713,"sku":"84761-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84761-2-rr","provider":"Iright","version":"1.0","type":"link"}