{"product_id":"proteintech-84763-4-rr","title":"Proteintech, 84763-4-RR, PACSIN2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PACSIN2 (84763-4-RR) by Proteintech is a Recombinant antibody targeting PACSIN2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n84763-4-RR targets PACSIN2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HepG2 cells,  NIH\/3T3 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPeripheral membrane proteins of the Bin\/amphiphysin\/Rvs (BAR) and Fer-CIP4 homology-BAR (F-BAR) family participate in cellular membrane trafficking (PMID: 19549836). PACSIN2 (also known as syndapin-2) is a member of the protein kinase C and casein kinase substrate in neurons (PACSIN) family, which are membrane-binding proteins characterized by an amino-terminal F-BAR domain. PACSIN2 plays a role in intracellular vesicle-mediated transport. It is involved in the endocytosis of cell-surface receptors like the EGF receptor, contributing to its internalization (PMID: 23129763). PACSIN2 also has a role in caveolae membrane sculpting (PMID: 21610094).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0809 Product name: Recombinant human PACSIN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-486 aa of BC008037 Sequence: PSLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAIQ Predict reactive species\nFull Name: protein kinase C and casein kinase substrate in neurons 2\nCalculated Molecular Weight: 56 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC008037\nGene Symbol: PACSIN2\nGene ID (NCBI): 11252\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9UNF0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888654110889,"sku":"84763-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84763-4-rr","provider":"Iright","version":"1.0","type":"link"}