Proteintech, 84776-2-RR, RAB21 Recombinant monoclonal antibody

Size: 20ul / 100ul The RAB21 (84776-2-RR) by Proteintech is a Recombinant antibody targeting RAB21 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 84776-2-RR targets RAB21 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, HepG2 cells, LNCaP cells, MDA-MB-231 cells Positive IHC detected in: human colon tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information Small GTPase Rab21 is a ubiquitously expressed and has recently been shown to associate with the α tails of several integrins via the shared conserved membrane proximal sequence, thus regulating cell adhesion and migration via controlling the endo/exocytic trafficking of most integrin heterodimers (PMID: 18804435). Rab21 is required for the pruning of the immature neurites during the multipolar-to-bipolar transition (PMID: 36683567). Knock down of Rab21 impairs integrin-mediated cell adhesion and motility, whereas its overexpression stimulates cell migration and cancer cell adhesion to collagen and human bone (PMID: 16754960). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35291 Product name: Recombinant human RAB21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 115-225 aa of NM_014999 Sequence: KELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG Predict reactive species Full Name: RAB21, member RAS oncogene family Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: NM_014999 Gene Symbol: RAB21 Gene ID (NCBI): 23011 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UL25 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.