{"product_id":"proteintech-84776-2-rr","title":"Proteintech, 84776-2-RR, RAB21 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RAB21 (84776-2-RR) by Proteintech is a Recombinant antibody targeting RAB21 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n84776-2-RR targets RAB21 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  HepG2 cells,  LNCaP cells,  MDA-MB-231 cells\nPositive IHC detected in: human colon tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSmall GTPase Rab21 is a ubiquitously expressed and has recently been shown to associate with the α tails of several integrins via the shared conserved membrane proximal sequence, thus regulating cell adhesion and migration via controlling the endo\/exocytic trafficking of most integrin heterodimers (PMID: 18804435). Rab21 is required for the pruning of the immature neurites during the multipolar-to-bipolar transition (PMID: 36683567). Knock down of Rab21 impairs integrin-mediated cell adhesion and motility, whereas its overexpression stimulates cell migration and cancer cell adhesion to collagen and human bone (PMID: 16754960).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35291 Product name: Recombinant human RAB21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 115-225 aa of NM_014999 Sequence: KELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG Predict reactive species\nFull Name: RAB21, member RAS oncogene family\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: NM_014999\nGene Symbol: RAB21\nGene ID (NCBI): 23011\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UL25\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888812347561,"sku":"84776-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84776-2-rr","provider":"Iright","version":"1.0","type":"link"}