{"product_id":"proteintech-84816-4-rr","title":"Proteintech, 84816-4-RR, FceR1a Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FceR1a (84816-4-RR) by Proteintech is a Recombinant antibody targeting FceR1a in WB, ELISA applications with reactivity to mouse samples\n84816-4-RR targets FceR1a in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MC\/9 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFc epsilon Receptor I alpha (FceR1a) is a single-pass type I membrane protein that contains 2 immunoglobulin-like domains. FceR1a forms a tetrameric complex with one beta and two gamma subunits (PMID: 19406478). FceRI is the high-affinity receptor for the Fc region of immunoglobulin E (IgE) (PMID: 1532373). It is expressed on mast cells and basophils and plays a central role in the allergic response (PMID: 2148316).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1740 Product name: Recombinant Mouse Fc-epsilon RI-alpha (FcERI) protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-204 aa of NM_010184.2 Sequence: ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQ Predict reactive species\nFull Name: Fc receptor, IgE, high affinity I, alpha polypeptide\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: NM_010184.2\nGene Symbol: FceR1a\nGene ID (NCBI): 14125\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P20489\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888745304233,"sku":"84816-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84816-4-rr","provider":"Iright","version":"1.0","type":"link"}