{"product_id":"proteintech-84818-5-rr","title":"Proteintech, 84818-5-RR, GOLIM4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GOLIM4 (84818-5-RR) by Proteintech is a Recombinant antibody targeting GOLIM4 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n84818-5-RR targets GOLIM4 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  MCF-7 cells,  HT-1080 cells,  L02 cells,  C2C12 cells\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: U-2 OS, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGolgi integral membrane protein 4 (GOLIM4) is a 130-kDa membrane protein that is integrated into the cis\/medial Golgi apparatus, which is a kind II Golgi protein. GOLIM4 is a Golgi protein that circulates between Golgi apparatus and\nendosomes, and its shuttle is pH sensitive(PMID:30068697).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34962 Product name: Recombinant human GOLIM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 350-500 aa of NM_014498 Sequence: QVGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAEDQGIQ Predict reactive species\nFull Name: golgi integral membrane protein 4\nCalculated Molecular Weight: 82 kDa\nObserved Molecular Weight: 130-140 kDa\nGenBank Accession Number: NM_014498\nGene Symbol: GOLIM4\nGene ID (NCBI): 27333\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O00461\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888757166249,"sku":"84818-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84818-5-rr","provider":"Iright","version":"1.0","type":"link"}