{"product_id":"proteintech-84830-5-rr","title":"Proteintech, 84830-5-RR, DGKZ Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DGKZ (84830-5-RR) by Proteintech is a Recombinant antibody targeting DGKZ in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n84830-5-RR targets DGKZ in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, mouse brain tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDiacylglycerol kinase zeta (DGKZ), also known as DAGK5, DAGK6, DGK-ZETA, hDGKzeta,  belongs to the diacylglycerol kinase (DGK) family which catalyzes diacylglycerol (DAG) into phosphatidic acid (PA). DGKZ is a novel promoter of metastasis and that it could be a potential prognostic indicator in patients with triple-negative breast cancer by suppressing lipid raft-dependent endocytosis of TGFbetaR2(PMID: 35115500). Downregulation of DGKZ suppresses tumorigenesis and progression of cervical cancer by facilitating cell apoptosis and cell cycle arrest(PMID: 33926342).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag37336 Product name: Recombinant human DGKZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 750-982 aa of NM_001199267.1 Sequence: LDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV Predict reactive species\nFull Name: diacylglycerol kinase, zeta 104kDa\nCalculated Molecular Weight: 104kDa，928aa\nObserved Molecular Weight: 104-124 kDa\nGenBank Accession Number: NM_001199267.1\nGene Symbol: DGKZ\nGene ID (NCBI): 8525\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q13574\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888735441065,"sku":"84830-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84830-5-rr","provider":"Iright","version":"1.0","type":"link"}