Proteintech, 84835-2-RR, SMC2 Recombinant monoclonal antibody

Size: 20ul / 100ul The SMC2 (84835-2-RR) by Proteintech is a Recombinant antibody targeting SMC2 in WB, ELISA applications with reactivity to human, mouse samples 84835-2-RR targets SMC2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, Raji cells, HepG2 cells, A431 cells, HEK-293T cells, C2C12 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SMC2 is a central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases (PMID: 11136719). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33471 Product name: Recombinant human SMC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1000-1197 aa of NM_001042550.1 Sequence: DLMKKKRIVENDKSKILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQCQNGKISKEAKSKAKPPKGAHVEV Predict reactive species Full Name: structural maintenance of chromosomes 2 Calculated Molecular Weight: 136 kDa Observed Molecular Weight: 135-140 kDa GenBank Accession Number: NM_001042550.1 Gene Symbol: SMC2 Gene ID (NCBI): 10592 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O95347 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.