{"product_id":"proteintech-84871-4-rr","title":"Proteintech, 84871-4-RR, ALDH7A1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ALDH7A1 (84871-4-RR) by Proteintech is a Recombinant antibody targeting ALDH7A1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n84871-4-RR targets ALDH7A1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  HEK-293T cells,  A549 cells,  A431 cells,  mouse liver tissue,  rat liver tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nALDH7A1(Alpha-aminoadipic semialdehyde dehydrogenase) is also named as ATQ1 and belongs to the aldehyde dehydrogenase family. It plays a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0383 Product name: Recombinant human ALDH7A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 196-398 aa of BC002515 Sequence: SLISVAVTKIIAKVLEDNKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHT Predict reactive species\nFull Name: aldehyde dehydrogenase 7 family, member A1\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC002515\nGene Symbol: ALDH7A1\nGene ID (NCBI): 501\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P49419\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888691597481,"sku":"84871-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84871-4-rr","provider":"Iright","version":"1.0","type":"link"}