{"product_id":"proteintech-84872-5-rr","title":"Proteintech, 84872-5-RR, AKR1C3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe AKR1C3 (84872-5-RR) by Proteintech is a Recombinant antibody targeting AKR1C3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n84872-5-RR targets AKR1C3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, A549 cells,  HepG2 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAKR1C3(Aldo-keto reductase family 1 member C3) is also named as DDH1, HSD17B5, KIAA0119, PGFS and belongs to AKR1C family. .In humans, at least four AKR1C isoforms exist: AKR1C1, AKR1C2, AKR1C3, AKR1C4 and AKR1C3 shares \u0026gt;86% sequence identity with these three highly related human AKRs(PMID:18574251). It catalyzes the conversion of aldehydes and ketones to alcohols and androgen, estrogen, PG, xenobiotics metabolism.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1674 Product name: Recombinant human AKR1C3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-323 aa of BC019230 Sequence: MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY Predict reactive species\nFull Name: aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)\nCalculated Molecular Weight: 323 aa, 37 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC019230\nGene Symbol: AKR1C3\nGene ID (NCBI): 8644\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P42330\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888691171497,"sku":"84872-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84872-5-rr","provider":"Iright","version":"1.0","type":"link"}