{"product_id":"proteintech-84885-4-rr","title":"Proteintech, 84885-4-RR, Glutamate receptor 3\/GluA3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Glutamate receptor 3\/GluA3 (84885-4-RR) by Proteintech is a Recombinant antibody targeting Glutamate receptor 3\/GluA3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n84885-4-RR targets Glutamate receptor 3\/GluA3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. GRIA3 (Glutamate ionotropic receptor AMPA type subunit 3), also known as Glutamate receptor R3 or A3 (GluR3 or GluA3), is associated with X-linked intellectual disability (ID), dysmorphic features, and non-syndromic epilepsy(PMID: 32977175). GRIA3 also plays a role as a mediator of tumor progression in pancreatic cancer downstream CUX1(PMID: 20689760).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag30898 Product name: Recombinant human GRIA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 288-425 aa of NM_007325 Sequence: VRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASSENRTI Predict reactive species\nFull Name: glutamate receptor, ionotrophic, AMPA 3\nCalculated Molecular Weight: 101 kDa\nObserved Molecular Weight: 101 kDa\nGenBank Accession Number: NM_007325\nGene Symbol: GRIA3\nGene ID (NCBI): 2892\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P42263\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888756084905,"sku":"84885-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84885-4-rr","provider":"Iright","version":"1.0","type":"link"}