{"product_id":"proteintech-84893-5-rr","title":"Proteintech, 84893-5-RR, ARK5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ARK5 (84893-5-RR) by Proteintech is a Recombinant antibody targeting ARK5 in IF\/ICC, ELISA applications with reactivity to human samples\n84893-5-RR targets ARK5 in IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNUAK1 is a member of the human adenosine monophosphate (AMP)-activated protein kinase family that has been identified as a key tumor cell survival factor. It is also named as ARK5, KIAA0537, OMPHK1 and belongs to the protein kinase superfamily. The physiological role of NUAK1 is potentially to suppress glucose uptake through negative regulation of INS signaling in oxidative muscle. This protein has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag18832 Product name: Recombinant human NUAK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 515-662 aa of BC152462 Sequence: HSLSCRRKGILKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAEGLSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQALEICSKLN Predict reactive species\nFull Name: NUAK family, SNF1-like kinase, 1\nCalculated Molecular Weight: 661 aa, 74 kDa\nGenBank Accession Number: BC152462\nGene Symbol: ARK5\nGene ID (NCBI): 9891\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O60285\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888852619433,"sku":"84893-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84893-5-rr","provider":"Iright","version":"1.0","type":"link"}