Proteintech, 84898-3-RR, LARP2 Recombinant monoclonal antibody

Size: 20ul / 100ul The LARP2 (84898-3-RR) by Proteintech is a Recombinant antibody targeting LARP2 in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84898-3-RR targets LARP2 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11043 Product name: Recombinant human LARP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC030516 Sequence: MDSRDHGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE Predict reactive species Full Name: La ribonucleoprotein domain family, member 2 Calculated Molecular Weight: 201 aa, 24 kDa GenBank Accession Number: BC030516 Gene Symbol: LARP2 Gene ID (NCBI): 55132 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q659C4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.