{"product_id":"proteintech-84913-1-rr","title":"Proteintech, 84913-1-RR, IMPDH1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe IMPDH1 (84913-1-RR) by Proteintech is a Recombinant antibody targeting IMPDH1 in WB, ELISA applications with reactivity to human samples\n84913-1-RR targets IMPDH1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, HeLa cells,  A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIMPDH1(Inosine-5'-monophosphate dehydrogenase 1) is also named as IMPD1, IMP dehydrogenase 1 and belongs to the IMPDH\/GMPR family. It catalyzes the rate limiting step of de novo guanine synthesis and an important target for the development of drugs with both chemotherapeutic and immunosuppressive activity. It may also have a role in the development of malignancy and the growth progression of some tumors. This protein has some isoforms produced by alternative splicing with the molecular mass of 53-65 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag17473 Product name: Recombinant human IMPDH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 170-235 aa of BC033622 Sequence: LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELV Predict reactive species\nFull Name: IMP (inosine monophosphate) dehydrogenase 1\nCalculated Molecular Weight: 563 aa, 60 kDa\nObserved Molecular Weight: 53-60 kDa\nGenBank Accession Number: BC033622\nGene Symbol: IMPDH1\nGene ID (NCBI): 3614\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P20839\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888769683625,"sku":"84913-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84913-1-rr","provider":"Iright","version":"1.0","type":"link"}