Proteintech, 84917-5-RR, SHOC2/Sur-8 Recombinant monoclonal antibody

Size: 20ul / 100ul The SHOC2/Sur-8 (84917-5-RR) by Proteintech is a Recombinant antibody targeting SHOC2/Sur-8 in WB, ELISA applications with reactivity to human samples 84917-5-RR targets SHOC2/Sur-8 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SHOC2 is also named as Sur-8. The SHOC2 protein, along with MRAS and PP1C, forms a high affinity, heterotrimeric holoenzyme that activates RAF kinases by dephosphorylating a specific phosphoserine (PMID: 37074066). SHOC2, a key protein mediating the Ras-Raf-ERK pathway, could act as a scaffolding protein to facilitate the activation of the pathway by mediating the interaction of key components of the pathway (PMID: 37170083). The scaffold protein Shoc2 is a critical modulator of ERK1/2 signals, and mutations in the shoc2 gene lead to the human developmental disease known as Noonan-like syndrome with loose anagen hair (NSLH) (PMID: 36265687). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11754 Product name: Recombinant human SHOC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 235-583 aa of BC050445 Sequence: GELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLKMQGPYRAMV Predict reactive species Full Name: soc-2 suppressor of clear homolog (C. elegans) Calculated Molecular Weight: 582 aa, 65 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC050445 Gene Symbol: SHOC2/Sur-8 Gene ID (NCBI): 8036 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UQ13 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.