{"product_id":"proteintech-84918-5-rr","title":"Proteintech, 84918-5-RR, HECTD1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HECTD1 (84918-5-RR) by Proteintech is a Recombinant antibody targeting HECTD1 in WB, ELISA applications with reactivity to human samples\n84918-5-RR targets HECTD1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHECTD1 (E3 ubiquitin-protein ligase), which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates,may be required for development of the head mesenchyme and neural tube closure.It is also involved in sporadic Parkinson's disease(PMID:16714300).This antibody is specific to HECTD1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14581 Product name: Recombinant human HECTD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-121 aa of BC006237 Sequence: PGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATMEKGFHLN Predict reactive species\nFull Name: HECT domain containing 1\nCalculated Molecular Weight: 2612 aa, 290 kDa\nObserved Molecular Weight: 290 kDa\nGenBank Accession Number: BC006237\nGene Symbol: HECTD1\nGene ID (NCBI): 25831\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9ULT8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888641560745,"sku":"84918-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84918-5-rr","provider":"Iright","version":"1.0","type":"link"}