{"product_id":"proteintech-84929-6-rr","title":"Proteintech, 84929-6-RR, TYRO3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TYRO3 (84929-6-RR) by Proteintech is a Recombinant antibody targeting TYRO3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n84929-6-RR targets TYRO3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTYRO3 has a structure includes a cytoplasmic domain and an extracellular ligand binding region. And ligand binding at the cell surface induces dimerization and autophosphorylation of TYRO3 on its intracellular domain that provides docking sites for downstream signaling molecules. TYRO3 is associated with many physiological processes including cell survival, migration and differentiation. It has been reported that TYRO3 can be expressed in various regions of the mammalian central nervous system. The molecular mass of TYRO3 is 130 kDa, the apparent molecular mass is higher due to glycosylation.((PMID: 8873131, 23354874, 21539887)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29527 Product name: Recombinant human TYRO3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 451-596 aa of BC049368 Sequence: LRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDSSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRL Predict reactive species\nFull Name: TYRO3 protein tyrosine kinase\nCalculated Molecular Weight: 97 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC049368\nGene Symbol: TYRO3\nGene ID (NCBI): 7301\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q06418\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888522088617,"sku":"84929-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84929-6-rr","provider":"Iright","version":"1.0","type":"link"}