Iright
BRAND / VENDOR: Proteintech

Proteintech, 84932-4-RR, TEAD4 Recombinant monoclonal antibody

CATALOG NUMBER: 84932-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The TEAD4 (84932-4-RR) by Proteintech is a Recombinant antibody targeting TEAD4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84932-4-RR targets TEAD4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, BGC-823 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information TEAD4 belongs to a protein family that shares the TEA/ATTS domain. The transcriptional activity of TEAD4 required several regions of the proteins, a TBP-associated factor, and a limiting transcriptional intermediary factor. TEAD4 also performs an essential role in the Hippo signaling pathway. TEAD4 regulates gene expression of YAP1 and WWTR1/TAZ, thus mediating cell proliferation, migration, and epithelial-mesenchymal transition induction. The calculated molecular weight of TEAD4 is 48 kDa, but the molecular weight of TEAD4 is detected at about 50-55 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3059 Product name: Recombinant human TEAD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 135-434 aa of BC015497 Sequence: SAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE Predict reactive species Full Name: TEA domain family member 4 Calculated Molecular Weight: 434 aa, 48 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC015497 Gene Symbol: TEAD4 Gene ID (NCBI): 7004 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15561 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924