{"product_id":"proteintech-84932-4-rr","title":"Proteintech, 84932-4-RR, TEAD4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TEAD4 (84932-4-RR) by Proteintech is a Recombinant antibody targeting TEAD4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n84932-4-RR targets TEAD4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDA-MB-231 cells, BGC-823 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTEAD4 belongs to a protein family that shares the TEA\/ATTS domain. The transcriptional activity of TEAD4 required several regions of the proteins, a TBP-associated factor, and a limiting transcriptional intermediary factor. TEAD4 also performs an essential role in the Hippo signaling pathway. TEAD4 regulates gene expression of YAP1 and WWTR1\/TAZ, thus mediating cell proliferation, migration, and epithelial-mesenchymal transition induction. The calculated molecular weight of TEAD4 is 48 kDa, but the molecular weight of TEAD4 is detected at about 50-55 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3059 Product name: Recombinant human TEAD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 135-434 aa of BC015497 Sequence: SAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE Predict reactive species\nFull Name: TEA domain family member 4\nCalculated Molecular Weight: 434 aa, 48 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC015497\nGene Symbol: TEAD4\nGene ID (NCBI): 7004\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15561\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888830206121,"sku":"84932-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84932-4-rr","provider":"Iright","version":"1.0","type":"link"}