Proteintech, 84934-1-RR, PSMC3IP Recombinant monoclonal antibody

Size: 20ul / 100ul The PSMC3IP (84934-1-RR) by Proteintech is a Recombinant antibody targeting PSMC3IP in WB, IHC, ELISA applications with reactivity to human, mouse samples 84934-1-RR targets PSMC3IP in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, mouse testis tissue, HEK-293 cells, MCF-7 cells, K-562 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information PSMC3IP, also called HOP2, encodes a protein that functions in meiotic recombination. It is a subunit of the PSMC3IP/MND1 complex, which interacts with PSMC3/TBP1 to stimulate DMC1- and RAD51-mediated strand exchange during meiosis. The protein encoded by this gene can also co-activate ligand-driven transcription mediated by estrogen, androgen, glucocorticoid, progesterone, and thyroid nuclear receptors. Mutations in this gene cause XX female gonadal dysgenesis. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1883 Product name: Recombinant human PSMC3IP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC008792 Sequence: MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKIYFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAEMQKEIQELKKECAGYRERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP Predict reactive species Full Name: PSMC3 interacting protein Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 24-29 kDa GenBank Accession Number: BC008792 Gene Symbol: PSMC3IP Gene ID (NCBI): 29893 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9P2W1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.