{"product_id":"proteintech-84943-2-rr","title":"Proteintech, 84943-2-RR, APOH Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe APOH (84943-2-RR) by Proteintech is a Recombinant antibody targeting APOH in WB, IHC, ELISA applications with reactivity to human samples\n84943-2-RR targets APOH in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nApolipoprotein H (ApoH), also known as beta2-glycoprotein I (B2-GPI), is a plasma glycoprotein, primarily synthesized in the liver. It has an important function in blood coagulation and clearance of apoptotic bodies from the circulation. ApoH is also an important actor of host innate immune response through its capacity to bind with high affinity to a large panel of pathogens or their proteins. ApoH is a 54 kDa plasma glycoprotein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3084 Product name: Recombinant Human APOH protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-345 aa of NM_000042.2 Sequence: GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC Predict reactive species\nFull Name: apolipoprotein H (beta-2-glycoprotein I)\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 43-55 kDa\nGenBank Accession Number: NM_000042.2\nGene Symbol: APOH\nGene ID (NCBI): 350\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P02749\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888707260585,"sku":"84943-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84943-2-rr","provider":"Iright","version":"1.0","type":"link"}