{"product_id":"proteintech-84960-4-rr","title":"Proteintech, 84960-4-RR, PTH Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PTH (84960-4-RR) by Proteintech is a Recombinant antibody targeting PTH in WB, ELISA applications with reactivity to human samples\n84960-4-RR targets PTH in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Recombinant protein\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nParathyroid hormone (PTH) is a crucial hormone secreted by the parathyroid glands. The main function of PTH is to regulate calcium and phosphorus metabolism in vertebrates. It increases blood calcium levels and decreases blood phosphorus levels. PTH also plays a role in maintaining bone health and is involved in the regulation of vitamin D metabolism.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3191 Product name: Recombinant Human PTH protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-115 aa of NM_000315.4 Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ Predict reactive species\nFull Name: parathyroid hormone\nCalculated Molecular Weight: 13kDa\nGenBank Accession Number: NM_000315.4\nGene Symbol: PTH\nGene ID (NCBI): 5741\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P01270\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888811757737,"sku":"84960-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84960-4-rr","provider":"Iright","version":"1.0","type":"link"}