Proteintech, 84963-5-RR, SUGT1 Recombinant monoclonal antibody

Size: 20ul / 100ul The SUGT1 (84963-5-RR) by Proteintech is a Recombinant antibody targeting SUGT1 in WB, IF/ICC, ELISA applications with reactivity to human samples 84963-5-RR targets SUGT1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2275 Product name: Recombinant human SUGT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-333 aa of BC000911 Sequence: MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY Predict reactive species Full Name: SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 38-41 kDa GenBank Accession Number: BC000911 Gene Symbol: SUGT1 Gene ID (NCBI): 10910 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9Y2Z0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.