{"product_id":"proteintech-84970-1-rr","title":"Proteintech, 84970-1-RR, PBK\/SPK Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PBK\/SPK (84970-1-RR) by Proteintech is a Recombinant antibody targeting PBK\/SPK in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n84970-1-RR targets PBK\/SPK in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  MCF-7 cells,  Jurkat cells,  L02 cells,  mouse testis tissue,  rat testis tissue\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPBK(PDZ-binding kinase) is also named as TOPK, CT84, Nori-3, SPK and belongs to the MAP kinase kinase subfamily. PBK may have a role in the regulation of cellular proliferation and progression of the cell cycle. It has a characteristic cdc2ycyclin B phosphorylation site(SyT-P-X-KyR) at its N terminus,which is conserved across species, and it is phosphorylated in a cell cycle-dependent manner at mitosis, and that this phosphorylation is required for its activation(PMID:10779557).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag9033 Product name: Recombinant human SPK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-322 aa of BC015191 Sequence: MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV Predict reactive species\nFull Name: PDZ binding kinase\nCalculated Molecular Weight: 322 aa, 36 kDa\nObserved Molecular Weight: 36-40 kDa\nGenBank Accession Number: BC015191\nGene Symbol: PBK\nGene ID (NCBI): 55872\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96KB5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888796717225,"sku":"84970-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84970-1-rr","provider":"Iright","version":"1.0","type":"link"}