{"product_id":"proteintech-84977-1-rr","title":"Proteintech, 84977-1-RR, SPOCK1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SPOCK1 (84977-1-RR) by Proteintech is a Recombinant antibody targeting SPOCK1 in WB, IHC, ELISA applications with reactivity to human samples\n84977-1-RR targets SPOCK1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, PC-3 eclls,  HEK-293T cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPOCK1, also known as TICN1. It is predicted to be located in the extracellular matrix. The proein may play a role in cell-cell and cell-matrix interactions and may contribute to various neuronal mechanisms in the central nervous system. The molecular weight of SPOCK1 is 49 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag28204 Product name: Recombinant human SPOCK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-236 aa of BC030691 Sequence: CVTQDYQTALCVSRKHLLPRQKKGNVAQKHWVGPSNLVKCKPCPVAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLATLCDGPCPCLPEPEPPKHKAERSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSNTAQGR Predict reactive species\nFull Name: sparc\/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1\nCalculated Molecular Weight: 439 aa, 49 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC030691\nGene Symbol: SPOCK1\nGene ID (NCBI): 6695\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q08629\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888826601641,"sku":"84977-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84977-1-rr","provider":"Iright","version":"1.0","type":"link"}