Proteintech, 84990-4-RR, TBC1D5 Recombinant monoclonal antibody

Size: 20ul / 100ul The TBC1D5 (84990-4-RR) by Proteintech is a Recombinant antibody targeting TBC1D5 in WB, IF/ICC, ELISA applications with reactivity to human samples 84990-4-RR targets TBC1D5 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, PC-3 cells, A431 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TBC1D5, a member of TBC (Tre2/Bub2/Cdc16)1 domain family, is a novel retromer-interacting protein. TBC1D5 is a Rab GTPase-activating proteins (GAPs) proteins that negatively regulates VPS35/29/26 recruitment and causes Rab7 to dissociate from the membrane. TBC1D5 could bridge the endosome and autophagosome via its C-terminal LIR motif, and Rab GAPs are implicated in the reprogramming of the endocytic trafficking events under starvation-induced autophagy. The TBC1D5 protein exists 89 kDa and 91 kDa isoforms. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10991 Product name: Recombinant human TBC1D5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 445-795 aa of BC013145 Sequence: TNAKGAPLNINKVSNSLINFGRKLISPAMAPGSAGGPVPGGNSSSSSSVVIPTRTSAEAPSHHLQQQQQQQRLMKSESMPVQLNKGLSSKNISSSPSVESLPGGREFTGSPPSSATKKDSFFSNISRSRSHSKTMGRKESEEELEAQISFLQGQLNDLDAMCKYCAKVMDTHLVNIQDVILQENLEKEDQILVSLAGLKQIKDILKGSLRFNQSQLEAEENEQITIADNHYCSSGQGQGRGQGQSVQMSGAIKQASSETPGCTDRGNSDDFILISKDDDGSSARGSFSGQAQPLRTLRSTSGKSQAPVCSPLVFSDPLMGPASASSSNPSSSPDDDSSKDSGFTIVSPLDI Predict reactive species Full Name: TBC1 domain family, member 5 Calculated Molecular Weight: 795 aa, 89 kDa Observed Molecular Weight: 89 kDa GenBank Accession Number: BC013145 Gene Symbol: TBC1D5 Gene ID (NCBI): 9779 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92609 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.