{"product_id":"proteintech-85000-4-rr","title":"Proteintech, 85000-4-RR, DCBLD2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DCBLD2 (85000-4-RR) by Proteintech is a Recombinant antibody targeting DCBLD2 in WB, IHC, IP, ELISA applications with reactivity to human samples\n85000-4-RR targets DCBLD2 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, U2OS cells\nPositive IP detected in: U2OS cells\nPositive IHC detected in: human colon cancer tissue, human rectal cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDCBLD2, also known as ESDN or CLCP1, was first identified from human coronary arterial cells by a signal sequence trap method. DCBLD2 regulates proliferation, migration, and invasion in various tumors, including glioma, hypopharyngeal squamous cell carcinoma, and myxofibrosarcoma. The human DCBLD2 protein has a predicted molecular mass of ∼80 kDa based on its amino acid sequence, although it regularly displays an effective molecular mass of ∼130 kDa via SDS-PAGE (PMID: 30902898).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag32823 Product name: Recombinant human DCBLD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 582-743 aa of BC029658 Sequence: LQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDVFKEIL Predict reactive species\nFull Name: discoidin, CUB and LCCL domain containing 2\nCalculated Molecular Weight: 775 aa, 89 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC029658\nGene Symbol: DCBLD2\nGene ID (NCBI): 131566\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q96PD2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888418869417,"sku":"85000-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85000-4-rr","provider":"Iright","version":"1.0","type":"link"}