{"product_id":"proteintech-85004-1-rr","title":"Proteintech, 85004-1-RR, NCOA5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NCOA5 (85004-1-RR) by Proteintech is a Recombinant antibody targeting NCOA5 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n85004-1-RR targets NCOA5 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: A431 cells\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNuclear receptor coactivator 5 (NCOA5), also known as a coactivator independent of AF-2 (CIA), possesses both repressor and activator functions (PMID: 11113208). It can interact with Estrogen Receptor (ER) alpha and ER beta in a ligand-dependent manner. NCOA5 has been shown to regulate the ER alpha-mediated transcription and the c-Myc gene expression (PMID: 11113208; 15073177). Recently identified as a conserved component of pluripotent stem cells, mammalian NCOA5 may contribute to maintaining the pluripotent stem cell population (PMID: 24268775).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14418 Product name: Recombinant human NCOA5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 112-384 aa of BC056872 Sequence: DMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPG Predict reactive species\nFull Name: nuclear receptor coactivator 5\nCalculated Molecular Weight: 579 aa, 66 kDa\nGenBank Accession Number: BC056872\nGene Symbol: NCOA5\nGene ID (NCBI): 57727\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9HCD5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888788689065,"sku":"85004-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85004-1-rr","provider":"Iright","version":"1.0","type":"link"}