{"product_id":"proteintech-85017-4-rr","title":"Proteintech, 85017-4-RR, Selenoprotein P Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Selenoprotein P (85017-4-RR) by Proteintech is a Recombinant antibody targeting Selenoprotein P in WB, ELISA applications with reactivity to human samples\n85017-4-RR targets Selenoprotein P in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human milk\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSelenoprotein P, also known as SEPP1, is expressed in the liver and heart and secreted into the plasma(PMID: 8421687). Selenoprotein P is implicated as an extracellular antioxidant involved in the transport of selenium to extra-hepatic tissues via apolipoprotein E receptor-2 (apoER2) and provides selenium to tissues such as brain and testis. In humans, it exists in plasma as two isoforms of approximately 50 and 60 kDa(PMID:19453253). Selenoprotein P is a glycosylated protein and deglycosylation of SEPP1 results in 45 kDa and 35 kDa isoforms(PMID: 25298198).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag32952 Product name: Recombinant human Selenoprotein P protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-299 aa of NM_001085486.2 Sequence: SNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRS Predict reactive species\nFull Name: selenoprotein P, plasma, 1\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 45-60 kDa\nGenBank Accession Number: NM_001085486.2\nGene Symbol: Selenoprotein P\nGene ID (NCBI): 6414\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P49908\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888820080809,"sku":"85017-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85017-4-rr","provider":"Iright","version":"1.0","type":"link"}