Proteintech, 85023-2-RR, ZNF517 Recombinant monoclonal antibody

Size: 20ul / 100ul The ZNF517 (85023-2-RR) by Proteintech is a Recombinant antibody targeting ZNF517 in WB, ELISA applications with reactivity to human, mouse samples 85023-2-RR targets ZNF517 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The ZNF family genes are an ancient group of mammalian paralogous homologs, and ZNF517 has been continuously lost during evolution, and although ZNF517 may be involved in transcriptional regulation, its exact function is unknown. A partial deletion and down-regulation of ZNF517 gene expression in cutaneous malignant melanoma (CMM) has been noted. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag37110 Product name: Recombinant human ZNF517 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 280-390 aa of BC126161 Sequence: QKFHTGEKPFACTECGKAFCRRFTLNEHGRIHSGERPYRCLRCGQRFIRGSSLLKHHRLHAQEGAQDGGAGQGALLGAAQRPQAGDPPHECPVCGRPFRHNSLLLLHLRLH Predict reactive species Full Name: zinc finger protein 517 Observed Molecular Weight: 50 kDa GenBank Accession Number: BC126161 Gene Symbol: ZNF517 Gene ID (NCBI): 340385 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6ZMY9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.