{"product_id":"proteintech-85062-2-rr","title":"Proteintech, 85062-2-RR, PTPN22 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PTPN22 (85062-2-RR) by Proteintech is a Recombinant antibody targeting PTPN22 in WB, ELISA applications with reactivity to human samples\n85062-2-RR targets PTPN22 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, Raji cells,  Daudi cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTPN22(Tyrosine-protein phosphatase non-receptor type 22) is also named as LyP,PEP,PTPN8.It belongs to the protein-tyrosine phosphatase family and non-receptor class 4 subfamily.It acts as negative regulator of T-cell receptor (TCR) signaling.Defects in PTPN22 are a cause of susceptibility to systemic lupus erythematosus (SLE). It has some isoforms produced by alternative splicing with calculated molecular mass of 79-92 kDa, and apparent molecular mass of 100-110 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2397 Product name: Recombinant human PTPN22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-179 aa of BC017785 Sequence: MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF Predict reactive species\nFull Name: protein tyrosine phosphatase, non-receptor type 22 (lymphoid)\nCalculated Molecular Weight: 82 kDa, 92 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC017785\nGene Symbol: PTPN22\nGene ID (NCBI): 26191\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y2R2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888811921577,"sku":"85062-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85062-2-rr","provider":"Iright","version":"1.0","type":"link"}