{"product_id":"proteintech-85064-1-rr","title":"Proteintech, 85064-1-RR, SIGMAR1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SIGMAR1 (85064-1-RR) by Proteintech is a Recombinant antibody targeting SIGMAR1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n85064-1-RR targets SIGMAR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, COLO 320 cells,  C2C12 cells,  C6 cells,  mouse colon tissue,  ratcolon tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSIGMAR1, also named as OPRS1, SRBP, SIG-1R and AAG8, belongs to the ERG2 family. It is an endoplasmic reticulum chaperone that binds a wide variety of ligands, including neurosteroids, psychostimulants, and dextrobenzomorphans. SIGMAR1 is ubiquitously expressed, and is enriched in motor neurons of the brain and spinal cord. It plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. SIGMAR1 plays a role in several other cell functions including proliferation, survival and death. SDS-PAGE and Western blot analysis showed that SIGMAR1 has an apparent molecular mass of 25 kDa. SIGMAR1 has 5 isoforms with MW 21-27kDa and 12kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7351 Product name: Recombinant human SIGMAR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-223 aa of BC004899 Sequence: SEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP Predict reactive species\nFull Name: sigma non-opioid intracellular receptor 1\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC004899\nGene Symbol: SIGMAR1\nGene ID (NCBI): 10280\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99720\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888821981353,"sku":"85064-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85064-1-rr","provider":"Iright","version":"1.0","type":"link"}