Proteintech, 85068-5-RR, UFM1 Recombinant monoclonal antibody

Size: 20ul / 100ul The UFM1 (85068-5-RR) by Proteintech is a Recombinant antibody targeting UFM1 in WB, ELISA applications with reactivity to human samples 85068-5-RR targets UFM1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HuH-7 cells, HEK-293T cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information UFM1 (Ubiquitin-fold modifier 1) is a ubiquitin-like protein covalently conjugated with intracellular proteins through UFMylation (modification by UFM1), a process similar to ubiquitylation (PMID: 38141606). UFM1 is conjugated to its target proteins by E1-like activating enzyme UBE1DC1 and E2-like conjugating enzyme UFC1 in a manner analogous to ubiquitylation (PMID: 28234446; 33066455). At the molecular level, UFMylation is an important mediator of the protein function. Dysregulation of the UFM1 system, e.g., the knockout of UFMylation components, disturbs proteome homeostasis and triggers endoplasmic reticulum stress. Such changes are linked to developmental disorders, tumorigenesis, tissue injury, inflammation, and several hereditary neurological syndromes (PMID: 36932998). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8667 Product name: Recombinant human UFM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC005193 Sequence: MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC Predict reactive species Full Name: ubiquitin-fold modifier 1 Calculated Molecular Weight: 85 aa, 9 kDa Observed Molecular Weight: 9-12 kDa GenBank Accession Number: BC005193 Gene Symbol: UFM1 Gene ID (NCBI): 51569 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P61960 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.