{"product_id":"proteintech-85074-4-rr","title":"Proteintech, 85074-4-RR, NME2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NME2 (85074-4-RR) by Proteintech is a Recombinant antibody targeting NME2 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n85074-4-RR targets NME2 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, U-87 MG cells,  OVCAR-3 cells,  rat kidney tissue,  rat liver tissue,  mouse kidney tissue,  mouse liver tissue\nPositive IF\/ICC detected in: Jurkat cells\nPositive FC (Intra) detected in: HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.13 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNME2(non-metastatic cells 2, protein) is also named as NDKB(Nucleoside diphosphate kinase B), NM23B and belongs to the NDK family. It is involved in the phosphorylation of nucleoside diphosphates and interacts with membrane receptor and constituting a novel molecular regulatory mechanism of GPCR endocytosis. Refer to the epitope and protein detection, this antibody specifically recognizes NME2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag13913 Product name: Recombinant human NME2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC002476 Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE Predict reactive species\nFull Name: non-metastatic cells 2, protein (NM23B) expressed in\nCalculated Molecular Weight: 152 aa, 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC002476\nGene Symbol: NME2\nGene ID (NCBI): 4831\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P22392\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888437514409,"sku":"85074-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85074-4-rr","provider":"Iright","version":"1.0","type":"link"}