{"product_id":"proteintech-85089-1-rr","title":"Proteintech, 85089-1-RR, ASIC1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ASIC1 (85089-1-RR) by Proteintech is a Recombinant antibody targeting ASIC1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n85089-1-RR targets ASIC1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, mouse brain tissue,  LNCaP cells,  SH-SY5Y cells,  rat brain tissue,  mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nASIC1(Acid-sensing ion channel 1), also named as ACCN2, BNaC2 or amiloride-sensitive cation channel 2, is a member of the ASICs family. ASICs, an H+-gated subgroup of the epithelial Na+ channel\/degenerin (ENaC\/DEG) superfamily, are widely expressed throughout the central and peripheral nervous system and triggered by increased extracellular acidification (PMID: 28518134, 27941930). ASIC1 is a key player in acidosis-induced tumor growth and invasiveness. Clinically, alterations of ASIC1 are associated with poor survival in breast cancer (PMID: 26686084).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25941 Product name: Recombinant human ASIC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 464-528 aa of NM_001095 Sequence: MKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC Predict reactive species\nFull Name: amiloride-sensitive cation channel 2, neuronal\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: NM_001095\nGene Symbol: ASIC1\nGene ID (NCBI): 41\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P78348\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888589885609,"sku":"85089-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85089-1-rr","provider":"Iright","version":"1.0","type":"link"}