{"product_id":"proteintech-85120-1-rr","title":"Proteintech, 85120-1-RR, GPX8 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GPX8 (85120-1-RR) by Proteintech is a Recombinant antibody targeting GPX8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n85120-1-RR targets GPX8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  U-87 MG cells,  U2OS cells,  NIH\/3T3 cells,  rat uterus tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1250-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPX8(Probable glutathione peroxidase 8) is also named as GSHPx-8 and belongs to the glutathione peroxidase family. Glutathione peroxidase (GPx) reduces hydroperoxides, including hydrogen peroxides, in the presence of reduced glutathione as a means of protecting organisms from oxidative damage. Several GPx isozymes have been identified in animal cells and these have been classified into different groups according to their cellular location and substrate specificity. In humans, eight types of GPx have been identified from GPx1 to GPx8. The full length GPX8 has 209 amino acids and the molecular weight is 24 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag9930 Product name: Recombinant human GPX8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 38-209 aa of BC029424 Sequence: KFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVIIKKKEDL Predict reactive species\nFull Name: glutathione peroxidase 8 (putative)\nCalculated Molecular Weight: 209 aa, 24 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC029424\nGene Symbol: GPX8\nGene ID (NCBI): 493869\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TED1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888758018217,"sku":"85120-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85120-1-rr","provider":"Iright","version":"1.0","type":"link"}