{"product_id":"proteintech-85122-4-rr","title":"Proteintech, 85122-4-RR, GYS2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GYS2 (85122-4-RR) by Proteintech is a Recombinant antibody targeting GYS2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n85122-4-RR targets GYS2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:25000-1:100000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGYS2 (Glycogen Synthase 2) is a key enzyme involved in the synthesis of glycogen in the liver. It catalyzes the addition of glucose molecules to the growing glycogen chain, playing a crucial role in maintaining glucose homeostasis. GYS2 is essential for liver glycogen synthesis, which acts as a critical energy reserve for maintaining blood glucose levels, especially during fasting or prolonged exercise. Impairment of GYS2 function can lead to glycogen storage disease type 0 (GSD-0), characterized by hypoglycemia and liver glycogen deficiency. The GYS2 is highest expressed in the liver, and its expression in liver was significantly higher than other tissues. (PMID:39150597; PMID:37574425)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag18012 Product name: Recombinant human GYS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 604-703 aa of BC126310 Sequence: YYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN Predict reactive species\nFull Name: glycogen synthase 2 (liver)\nCalculated Molecular Weight: 703 aa, 81 kDa\nObserved Molecular Weight: 81 kDa\nGenBank Accession Number: BC126310\nGene Symbol: GYS2\nGene ID (NCBI): 2998\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P54840\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888759492777,"sku":"85122-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85122-4-rr","provider":"Iright","version":"1.0","type":"link"}