{"product_id":"proteintech-85128-6-rr","title":"Proteintech, 85128-6-RR, Foxp3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Foxp3 (85128-6-RR) by Proteintech is a Recombinant antibody targeting Foxp3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n85128-6-RR targets Foxp3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue, MJ cells,  rat thymus tissue,  mouse spleen tissue,  rat spleen tissue\nPositive IHC detected in: mouse spleen tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFOXP3, also named as IPEX, JM2 and Scurfin, is a transcription factor. FOXP3 plays a critical role in the control of immune response. Defects in FOXP3 are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX) which also known as X-linked autoimmunity-immunodeficiency syndrome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4360 Product name: Recombinant Mouse Foxp3 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 10007378 of Sequence: YPLLANGVCKWPGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALAKAPS Predict reactive species\nFull Name: forkhead box P3\nObserved Molecular Weight: 45 kDa\nGene Symbol: Foxp3\nGene ID (NCBI): 20371\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99JB6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888753725609,"sku":"85128-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85128-6-rr","provider":"Iright","version":"1.0","type":"link"}