{"product_id":"proteintech-85137-4-rr","title":"Proteintech, 85137-4-RR, RNF128 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RNF128 (85137-4-RR) by Proteintech is a Recombinant antibody targeting RNF128 in WB, ELISA applications with reactivity to human samples\n85137-4-RR targets RNF128 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 205 cells, HT-29 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNF128 (Ring Finger Protein 128), also known as GRAIL (Gene Related to Anergy in Lymphocytes), is an E3 ubiquitin ligase that plays key roles in immune regulation, tumor biology, and antiviral responses. Initially identified in T cells, it is highly expressed in anergic CD4+ T cells and contributes to the induction and maintenance of T-cell anergy by catalyzing the ubiquitination and degradation of critical T-cell signaling molecules such as CD40L, CD80, and Rho-family GTPases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag22834 Product name: Recombinant human RNF128 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 333-428 aa of BC063404 Sequence: DGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETAVREIKS Predict reactive species\nFull Name: ring finger protein 128\nCalculated Molecular Weight: 428 aa, 47 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC063404\nGene Symbol: RNF128\nGene ID (NCBI): 79589\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TEB7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888661123241,"sku":"85137-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85137-4-rr","provider":"Iright","version":"1.0","type":"link"}