Product Description
Size: 20ul / 100ul
The TANK (85138-3-RR) by Proteintech is a Recombinant antibody targeting TANK in WB, IP, ELISA applications with reactivity to human samples
85138-3-RR targets TANK in WB, IP, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A431 cells, THP-1 cells, Daudi cells, Raji cells, Ramos cells
Positive IP detected in: THP-1 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag25740 Product name: Recombinant human TANK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC003388 Sequence: MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI Predict reactive species
Full Name: TRAF family member-associated NFKB activator
Calculated Molecular Weight: 14 kDa
Observed Molecular Weight: 48 kDa
GenBank Accession Number: BC003388
Gene Symbol: TANK
Gene ID (NCBI): 10010
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q92844
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924