{"product_id":"proteintech-85155-4-rr","title":"Proteintech, 85155-4-RR, SOCS3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SOCS3 (85155-4-RR) by Proteintech is a Recombinant antibody targeting SOCS3 in WB, ELISA applications with reactivity to human, mouse samples\n85155-4-RR targets SOCS3 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, CTLL-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe suppressor of cytokine signaling (SOCS) family proteins are negative feedback system that inhibits cytokine signal transduction. One of the SOCS family, SOCS3, also named CIS3 and SSI3, is involved in inhibition of JAK\/STAT pathway which regulates IL-6 signaling in vivo. SOCS3 can be rapidly trigger by a number of factors including interleukins, IFN-gamma and TNF-alpha. Pathology such as inflammatory response, wound repair and obesity and so on have been linked to SOCS3. Observed MW of SOCS3 is from 22-30 kDa(PMID: 24827536,PMID: 26260587, PMID: 26797799).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5170 Product name: Recombinant human SOCS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC060858 Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL Predict reactive species\nFull Name: suppressor of cytokine signaling 3\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC060858\nGene Symbol: SOCS3\nGene ID (NCBI): 9021\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O14543\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888667709609,"sku":"85155-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85155-4-rr","provider":"Iright","version":"1.0","type":"link"}