{"product_id":"proteintech-85156-5-rr","title":"Proteintech, 85156-5-RR, NPM3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NPM3 (85156-5-RR) by Proteintech is a Recombinant antibody targeting NPM3 in IF\/ICC, ELISA applications with reactivity to human samples\n85156-5-RR targets NPM3 in IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNPM3, a member of the nucleophosmin\/ nucleoplasmin family, lacks intrinsic histone chaperone activity, inhibits histone assembly activity of NPM1 in vitro, and dramatically enhances transcription in a cellular system(PMID: 20073534). Human NPM3 is an abundant and widely expressed protein with primarily nuclear localization. The NPM3 protein migrated in SDS-PAGE gels as a doublet with apparent molecular masses of 25 and 27 kDa, which are larger than the 20.5 kDa mass predicted by the deduced amino acid sequence including the HA tag (PMID: 11722795).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2564 Product name: Recombinant human NPM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC054868 Sequence: MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP Predict reactive species\nFull Name: nucleophosmin\/nucleoplasmin, 3\nCalculated Molecular Weight: 178 aa, 19 kDa\nGenBank Accession Number: BC054868\nGene Symbol: NPM3\nGene ID (NCBI): 10360\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O75607\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888791900329,"sku":"85156-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85156-5-rr","provider":"Iright","version":"1.0","type":"link"}