{"product_id":"proteintech-85336-1-rr","title":"Proteintech, 85336-1-RR, BUD31 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe BUD31 (85336-1-RR) by Proteintech is a Recombinant antibody targeting BUD31 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n85336-1-RR targets BUD31 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse brain tissue,  U-251 cells,  Raji cells,  K-562 cells,  rat heart tissue,  fetal human brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2373 Product name: Recombinant human BUD31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC022821 Sequence: MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG Predict reactive species\nFull Name: BUD31 homolog (S. cerevisiae)\nCalculated Molecular Weight: 144 aa, 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC022821\nGene Symbol: BUD31\nGene ID (NCBI): 8896\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P41223\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888712962217,"sku":"85336-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85336-1-rr","provider":"Iright","version":"1.0","type":"link"}