{"product_id":"proteintech-85346-1-rr","title":"Proteintech, 85346-1-RR, DAPP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DAPP1 (85346-1-RR) by Proteintech is a Recombinant antibody targeting DAPP1 in WB, ELISA applications with reactivity to human samples\n85346-1-RR targets DAPP1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDAPP1 was identified as dual adaptor for phosphotyrosine and 3-phosphoinositides, a novel 280 amino acid protein which contains a putative myristoylation site at its N-terminus followed by a SH2 and a PH domain at its C-terminus (PMID: 10432293). DAPP1 is also referred to B cell adaptor molecule of 32 kDa (Bam32), and is expressed by B lymphocytes, but not T lymphocytes or nonhematopoietic cells. DAPP1\/Bam32 was shown to regulate BCR signaling downstream of phosphatidylinositol 3-kinase (PI3K) (PMID: 10770799). Furthermore, DAPP1\/Bam32 may server to integrate PI3K and Src kinase signaling to promote Rac-dependent B cell adhesive interactions important for antigen presentation function (PMID: 20495066).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6459 Product name: Recombinant human DAPP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC012924 Sequence: MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK Predict reactive species\nFull Name: dual adaptor of phosphotyrosine and 3-phosphoinositides\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC012924\nGene Symbol: DAPP1\nGene ID (NCBI): 27071\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UN19\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888734032041,"sku":"85346-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85346-1-rr","provider":"Iright","version":"1.0","type":"link"}