Proteintech, 85348-1-RR, RPL5 Recombinant monoclonal antibody

Size: 20ul / 100ul The RPL5 (85348-1-RR) by Proteintech is a Recombinant antibody targeting RPL5 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, monkey samples 85348-1-RR targets RPL5 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, monkey samples. Tested Applications Positive WB detected in: PC-3 cells, 3T3-L1 cells, A431 cells, HeLa cells, Jurkat cells, MOLT-4 cells, COS-7 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RPL5 (Ribosomal Protein L5) is a crucial component of the 60S ribosomal subunit, playing a significant role in ribosome biogenesis and function. It is required for rRNA maturation and the formation of the 60S ribosomal subunits. Defects or mutations in RPL5 are associated with Diamond-Blackfan anemia (DBA), a congenital disorder characterized by red blood cell aplasia.(PMID: 28376382) Specification Tested Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30837 Product name: Recombinant human RPL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-297 aa of BC109370 Sequence: KRFPGYDSESKEFNAEVHRKHIMGQNVADYMRCLMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAES Predict reactive species Full Name: ribosomal protein L5 Observed Molecular Weight: 34 kDa GenBank Accession Number: BC109370 Gene Symbol: RPL5 Gene ID (NCBI): 6125 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P46777 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.