Proteintech, 85388-1-RR, SMAD1 Recombinant monoclonal antibody

Size: 20ul / 100ul The SMAD1 (85388-1-RR) by Proteintech is a Recombinant antibody targeting SMAD1 in WB, IHC, FC (Intra), ELISA, ChIP-qPCR applications with reactivity to human, mouse, rat samples 85388-1-RR targets SMAD1 in WB, IHC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, HUVEC cells, HT-1080 cells, RAW264.7 cells, HSC-T6 cells Positive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells Positive ChIP-qPCR detected in: BMP2 (50 ng/ml, 1 h) MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information Transforming growth factor-β (TGF-β) superfamily is recognized as one of the largest families of secreted multifunctional peptides exerting different biological effects on a large variety of cell types, such as regulation of hormone secretion, stimulation of extracellular matrix formation, the inhibition of proliferation of many cell types, cell survival, bone formation, and chemotaxis for inflammatory cells. One of the most important proteins that modulate TGF-β ligand activity is the SMAD family proteins. SMAD1 is one of the receptor-activated Smads. It's also a signal transducers of BMP signaling and binds to several proteins involved in ubiquitin-proteasome system (UPS). Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0701 Product name: Recombinant human SMAD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-229 aa of BC001878 Sequence: GWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLP Predict reactive species Full Name: SMAD family member 1 Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC001878 Gene Symbol: SMAD1 Gene ID (NCBI): 4086 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15797 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.