Proteintech, 85394-1-RR, RAB9B Recombinant monoclonal antibody

Size: 20ul / 100ul The RAB9B (85394-1-RR) by Proteintech is a Recombinant antibody targeting RAB9B in WB, ELISA applications with reactivity to human samples 85394-1-RR targets RAB9B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Raji cells, THP-1 cells, K-562 cells, Jurkat cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information RAB9B, also named as RAB9L, is involved in the transport of proteins between the endosomes and the trans Golgi network. RAB9B belongs to the Ras-related superfamily of guanine nucleotide binding proteins, which includes the Ral/Rec, Rap, R-Ras, and Rho/Rab subfamilies Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12862 Product name: Recombinant human RAB9B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-201 aa of BC093756 Sequence: MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC Predict reactive species Full Name: RAB9B, member RAS oncogene family Calculated Molecular Weight: 201 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC093756 Gene Symbol: RAB9B Gene ID (NCBI): 51209 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NP90 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.