{"product_id":"proteintech-85599-4-rr","title":"Proteintech, 85599-4-RR, PDIR Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PDIR (85599-4-RR) by Proteintech is a Recombinant antibody targeting PDIR in WB, IHC, ELISA applications with reactivity to human, mouse samples\n85599-4-RR targets PDIR in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, L02 cells,  HeLa cells,  MCF-7 cells,  Jurkat cells,  mouse liver tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDIR(Protein disulfide isomerase-related protein), also known as PDIA5 (Protein Disulfide Isomerase Family A Member 5), is a member of the PDI gene family and also exhibits chaperone-like activity. PDIR protein is correlated with immune infiltration, which is highly expressed in glioma and participates in glioma progression(PMID: 33664747). PDIR contributes to disulfide bond rearrangement in ATF6α under stress conditions that necessary for ATF6α activation upon ER stress(PMID: 24636989).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag31479 Product name: Recombinant human PDIA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-170 aa of BC001625 Sequence: SSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEE Predict reactive species\nFull Name: protein disulfide isomerase family A, member 5\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC001625\nGene Symbol: PDIR\nGene ID (NCBI): 10954\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14554\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888797601961,"sku":"85599-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85599-4-rr","provider":"Iright","version":"1.0","type":"link"}