{"product_id":"proteintech-85639-6-rr","title":"Proteintech, 85639-6-RR, PFKFB2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PFKFB2 (85639-6-RR) by Proteintech is a Recombinant antibody targeting PFKFB2 in WB, ELISA applications with reactivity to human samples\n85639-6-RR targets PFKFB2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPFKFB2(6-Phosphofructo-2-kinase\/fructose 2,6-bisphosphatase 2) is also named as PFK-2\/FBPase-2, which is a bifunctional enzyme responsible for the synthesis and breakdown of Fru-2,6-P2 in the regulation of glycolysis(PMID:10095107). In the C-terminal section, it belongs to the phosphoglycerate mutase family. The enzyme is a dimer of identical subunits, each composed of 505 amino acids and containing three discrete domains(PMID: 2552438). It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag32347 Product name: Recombinant human PFKFB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 430-505 aa of BC075076 Sequence: CKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD Predict reactive species\nFull Name: 6-phosphofructo-2-kinase\/fructose-2,6-biphosphatase 2\nCalculated Molecular Weight: 505 aa, 58 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC075076\nGene Symbol: PFKFB2\nGene ID (NCBI): 5208\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O60825\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888798650537,"sku":"85639-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85639-6-rr","provider":"Iright","version":"1.0","type":"link"}