{"product_id":"proteintech-85663-5-rr","title":"Proteintech, 85663-5-RR, SF3B4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SF3B4 (85663-5-RR) by Proteintech is a Recombinant antibody targeting SF3B4 in WB, ELISA applications with reactivity to human, mouse, rat samples\n85663-5-RR targets SF3B4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293T cells,  Jurkat cells,  U2OS cells,  COLO 205 cells,  NIH\/3T3 cells,  C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSF3B4, also named as Pre-mRNA-splicing factor SF3b 49 kDa subunit, is a 424 amino acid protein, which belongs to the SF3B4 family. SF3B4 is a subunit of the splicing factor SF3B required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. SF3B4 has been found in complex 'B' and 'C' as well. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron. The calculated molecular weight of SF3B4 is 44 kDa. Based on its predicted molecular mass and the observed migration of the 50kDa cross-linked species on two-dimensional gels.(PMID: 9614130)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0737 Product name: Recombinant human SF3B4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC004273 Sequence: MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP Predict reactive species\nFull Name: splicing factor 3b, subunit 4, 49kDa\nCalculated Molecular Weight: 44 aa, 3 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC004273\nGene Symbol: SF3B4\nGene ID (NCBI): 10262\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15427\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888821293225,"sku":"85663-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85663-5-rr","provider":"Iright","version":"1.0","type":"link"}